Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004814 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-814 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-814 Supplier Abnova Corporation Supplier No. H00200576A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant PIP5K3.

PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM

Sequence: LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR

Specifications

Antigen phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant PIP5K3.
Formulation 50% glycerol
Gene PIP5K3
Gene Accession No. NM_152671
Gene Alias CFD/FAB1/KIAA0981/MGC40423/PIKFYVE/PIP5K
Gene Symbols PIP5K3
Host Species Mouse
Immunogen PIP5K3 (NP_689884, 342 a.a. ∼ 451 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Endocrine/Metabolism
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 200576
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.