Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PIP5K3.

Manufacturer:  Abnova Corporation H00200576A01

Catalog No. 89-004-814


Add to cart

Description

Description

PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM

Sequence: LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR
Specifications

Specifications

phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III
Unconjugated
50% glycerol
NM_152671
CFD|FAB1|KIAA0981|MGC40423|PIKFYVE|PIP5K
Mouse
50 uL
Endocrine/Metabolism
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PIP5K3.
PIP5K3
Serum
PIP5K3
PIP5K3 (NP_689884, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
200576
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit