Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000882

paired-like homeodomain 1, Mouse, Clone: 6D4, Abnova™

Catalog No. 89000882 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-882 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-882 Supplier Abnova Corporation Supplier No. H00005307M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PITX1.

This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. [provided by RefSeq

Sequence: MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN

Specifications

Antigen paired-like homeodomain 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6D4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PITX1.
Formulation PBS with no preservative; pH 7.4
Gene PITX1
Gene Accession No. NM_002653
Gene Alias BFT/POTX/PTX1
Gene Symbols PITX1
Host Species Mouse
Immunogen PITX1 (NP_002644, 225 a.a. ∼ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 5307
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.