paired-like homeodomain 1, Mouse, Clone: 6D4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PITX1.

Supplier:  Abnova Corporation H00005307M02

Catalog No. 89-000-882

Description

This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. [provided by RefSeq

Sequence: MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN

Specifications

• Antigen: paired-like homeodomain 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002653
• Gene Symbols: PITX1
• Immunogen: PITX1 (NP_002644, 225 a.a. ∼ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 6D4
• Description: Mouse monoclonal antibody raised against a partial recombinant PITX1.
• Gene: PITX1
• Gene Alias: BFT/POTX/PTX1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5307
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ