Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

praja ring finger 2, Mouse, Clone: 1G11, Abnova™

Catalog No. 89015844 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-015-844 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-015-844 Supplier Abnova Corporation Supplier No. H00009867M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant PJA2.

Sequence: REKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREALEVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGA

Specifications

Antigen praja ring finger 2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1G11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PJA2.
Formulation PBS with no preservative; pH 7.4
Gene PJA2
Gene Accession No. NM_014819
Gene Alias KIAA0438/Neurodap1/RNF131
Gene Symbols PJA2
Host Species Mouse
Immunogen PJA2 (NP_055634, 302 a.a. ∼ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Ubiquitin/Proteasome
Primary or Secondary Primary
Gene ID (Entrez) 9867
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.