praja ring finger 2, Mouse, Clone: 1G11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PJA2.

Supplier:  Abnova Corporation H00009867M01

Catalog No. 89-015-844

Description

Sequence: REKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREALEVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGA

Specifications

• Antigen: praja ring finger 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_014819
• Gene Symbols: PJA2
• Immunogen: PJA2 (NP_055634, 302 a.a. ∼ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Ubiquitin/Proteasome
• Gene ID (Entrez): 9867
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 1G11
• Description: Mouse monoclonal antibody raised against a partial recombinant PJA2.
• Gene: PJA2
• Gene Alias: KIAA0438/Neurodap1/RNF131
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody