PBX/knotted 1 homeobox 1, Mouse, Clone: 4F6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PKNOX1.

Supplier:  Abnova Corporation H00005316M01

Catalog No. 89-000-884

Description

Sequence: MATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQ

Specifications

• Antigen: PBX/knotted 1 homeobox 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004571
• Gene Symbols: PKNOX1
• Immunogen: PKNOX1 (NP_004562, 2 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4F6
• Description: Mouse monoclonal antibody raised against a partial recombinant PKNOX1.
• Gene: PKNOX1
• Gene Alias: PREP1/pkonx1c
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5316
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ