PLA2G1B, Mouse, Clone: 1B3, Abnova™

Catalog No.	Quantity
89-024-810	100 μg

Catalog No. 89-024-810 Supplier Abnova Corporation Supplier No. H00005319M01

Description

Mouse monoclonal antibody raised against a full-length recombinant PLA2G1B.

Phospholipase A2 (EC 3.1.1.4) catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. Sequences of pancreatic PLA2 enzymes from a variety of mammals have been reported. One striking feature of these enzymes is their close homology to venom phospholipases of snakes. Other forms of PLA2 have been isolated from brain, liver, lung, spleen, intestine, macrophages, leukocytes, erythrocytes, inflammatory exudates, chondrocytes, and platelets (Seilhamer et al., 1986 [PubMed 3028739]) .[supplied by OMIM

Sequence: SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV

Specifications

• Antigen: PLA2G1B
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant PLA2G1B.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PLA2G1B
• Gene Accession No.: BC005386
• Gene Alias: MGC119834/MGC119835/PLA2/PLA2A/PPLA2
• Gene Symbols: PLA2G1B
• Host Species: Mouse
• Immunogen: PLA2G1B (AAH05386, 17 a.a. ∼ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Unpurified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5319
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ