Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Placental Lactogen/CSH1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159302

Catalog No. NBP159302


Only null left
Add to Cart

Description

Description

Placental Lactogen/CSH1 Polyclonal specifically detects Placental Lactogen/CSH1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Placental Lactogen/CSH1
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
Choriomammotropin, chorionic somatomammotropin hormone, chorionic somatomammotropin hormone 1 (placental lactogen), CS-1, CSAchorionic somatomammotropin A, CSH2, CSMT, FLJ75407, hCS-A, Lactogen, Placental lactogen, PLchoriomammotropin
Rabbit
Protein A purified
RUO
Primary
Expected identity based on immunogen sequence: Human: 100%.
Human, Mouse, Rat, Canine, Guinea Pig, Rabbit
Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
1 mg/ml
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
P01243
CSH1
Synthetic peptides corresponding to CSH1 (chorionic somatomammotropin hormone 1 (placental lactogen)) The peptide sequence was selected from the middle region of CSH1. Peptide sequence SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS.
100 μL
Cytokine Research, Signal Transduction
1442
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only