pleiomorphic adenoma gene-like 1, Mouse, Clone: 1E2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PLAGL1.

Supplier:  Abnova Corporation H00005325M01A

Catalog No. 89-001-479

Description

This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Many transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL

Specifications

• Antigen: pleiomorphic adenoma gene-like 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_002656
• Gene Symbols: PLAGL1
• Immunogen: PLAGL1 (NP_002647.2, 221 a.a. ∼ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ

• Applications: ELISA, Western Blot
• Clone: 1E2
• Description: Mouse monoclonal antibody raised against a partial recombinant PLAGL1.
• Gene: PLAGL1
• Gene Alias: DKFZp781P1017/LOT1/MGC126275/MGC126276/ZAC/ZAC1
• Host Species: Mouse
• Quantity: 200 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 5325
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites