Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001479

pleiomorphic adenoma gene-like 1, Mouse, Clone: 1E2, Abnova™

Catalog No. 89001479 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-479 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-479 Supplier Abnova Corporation Supplier No. H00005325M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PLAGL1.

This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Many transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL

Specifications

Antigen pleiomorphic adenoma gene-like 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1E2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PLAGL1.
Formulation ascites with no preservative
Gene PLAGL1
Gene Accession No. NM_002656
Gene Alias DKFZp781P1017/LOT1/MGC126275/MGC126276/ZAC/ZAC1
Gene Symbols PLAGL1
Host Species Mouse
Immunogen PLAGL1 (NP_002647.2, 221 a.a. ∼ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 5325
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.