Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89018862

phospholipase C, beta 1 (phosphoinositide-specific), Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89018862 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-018-862 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-018-862 Supplier Abnova Corporation Supplier No. H00023236A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant PLCB1.

The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. This gene is activated by two G-protein alpha subunits, alpha-q and alpha-11. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: VQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL

Specifications

Antigen phospholipase C, beta 1 (phosphoinositide-specific)
Applications ELISA
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant PLCB1.
Formulation 50% glycerol
Gene PLCB1
Gene Accession No. NM_015192
Gene Alias FLJ45792/PI-PLC/PLC-154/PLC-I/PLC154
Gene Symbols PLCB1
Host Species Mouse
Immunogen PLCB1 (NP_056007, 1107 a.a. ∼ 1216 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Endocrine/Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 23236
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.