PLXNA2, Mouse, Clone: 2G5, Abnova™

Catalog No.	Quantity
89-123-266	100 μg

Catalog No. 89-123-266 Supplier Abnova Corporation Supplier No. H00005362M06

Description

Mouse monoclonal antibody raised against a full-length recombinant PLXNA2.

This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. [provided by RefSeq

Sequence: MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES

Specifications

• Antigen: PLXNA2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2G5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant PLXNA2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PLXNA2
• Gene Accession No.: BC032125
• Gene Alias: FLJ11751/FLJ30634/KIAA0463/OCT/PLXN2
• Gene Symbols: PLXNA2
• Host Species: Mouse
• Immunogen: PLXNA2 (AAH32125, 1 a.a. ∼ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5362
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ