Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PLXNA3, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89003157 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-003-157 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-003-157 Supplier Abnova Corporation Supplier No. H00055558A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant PLXNA3.

Sequence: FRAFVVTDTTLTHLAVHRVTGEVFVGAVNRVFKLAPNLTELRAHVTGPVEDNARCYPPPSMRVCAHRLAPVDNINKLLLIDYAARRLVACGSIWQGICQFLRLDDL

Specifications

Antigen PLXNA3
Applications ELISA
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant PLXNA3.
Formulation 50% glycerol
Gene PLXNA3
Gene Accession No. NM_017514
Gene Alias 6.3/HSSEXGENE/PLEXIN-A3/PLXN3/PLXN4/SEX/XAP-6
Gene Symbols PLXNA3
Host Species Mouse
Immunogen PLXNA3 (NP_059984, 23 a.a. ∼ 128 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55558
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.