phenylethanolamine N-methyltransferase (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PNMT.

Supplier:  Abnova Corporation H00005409A01

Catalog No. 89-004-249

Description

The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production. [provided by RefSeq

Sequence: MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQEL

Specifications

• Antigen: phenylethanolamine N-methyltransferase
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PNMT.
• Gene: PNMT
• Gene Alias: MGC34570/PENT/PNMTase
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 5409
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002686
• Gene Symbols: PNMT
• Immunogen: PNMT (NP_002677, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum