pyridoxamine 5'-phosphate oxidase (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-659	50 μL

Catalog No. 89-004-659 Supplier Abnova Corporation Supplier No. H00055163A01

Description

Mouse polyclonal antibody raised against a partial recombinant PNPO.

The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine. Mutations in this gene result in pyridoxamine 5'-phosphate oxidase (PNPO) deficiency, a form of neonatal epileptic encephalopathy. [provided by RefSeq]

Sequence: KSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP

Specifications

• Antigen: pyridoxamine 5'-phosphate oxidase
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PNPO.
• Formulation: 50% glycerol
• Gene: PNPO
• Gene Accession No.: NM_018129
• Gene Alias: FLJ10535/PDXPO
• Gene Symbols: PNPO
• Host Species: Mouse
• Immunogen: PNPO (NP_060599, 163 a.a. ∼ 261 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 55163
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum