protein O-fucosyltransferase 1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human POFUT1 protein.

Supplier:  Abnova Corporation H00023509D01P

Catalog No. 89-018-101

Description

This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq

Sequence: MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRRENHSCVTLLFPR

Specifications

• Antigen: protein O-fucosyltransferase 1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human POFUT1 protein.
• Gene: POFUT1
• Gene Alias: FUT12/KIAA0180/MGC2482/O-FUT/O-Fuc-T/O-FucT-1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_172236
• Gene Symbols: POFUT1
• Immunogen: POFUT1 (NP_758436.1, 1 a.a. ∼ 194 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 23509
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG