polymerase (RNA) I polypeptide B, 128kDa, Mouse, Clone: 4H6, Abnova™

Catalog No.	Quantity
89-001-371	100 μg

Catalog No. 89-001-371 Supplier Abnova Corporation Supplier No. H00084172M10

Description

Mouse monoclonal antibody raised against a partial recombinant POLR1B.

Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species. Most of the mass of the pol I complex derives from the 2 largest subunits, Rpa1 and Rpa2 in yeast. POLR1B is homologous to Rpa2 (Seither and Grummt, 1996 [PubMed 8921381]).[supplied by OMIM

Sequence: GEMLKAAGYNFYGTERLYSGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHVCVK

Specifications

• Antigen: polymerase (RNA) I polypeptide B, 128kDa
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 4H6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant POLR1B.
• Formulation: PBS with no preservative; pH 7.4
• Gene: POLR1B
• Gene Accession No.: NM_019014
• Gene Alias: FLJ10816/FLJ21921/MGC131780/RPA135/RPA2/Rpo1-2
• Gene Symbols: POLR1B
• Host Species: Mouse
• Immunogen: POLR1B (NP_061887, 963 a.a. ∼ 1072 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 84172
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ