polymerase (RNA) mitochondrial (DNA directed), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant POLRMT.

Supplier:  Abnova Corporation H00005442A01

Catalog No. 89-004-251

Description

This gene encodes a mitochondrial DNA-directed RNA polymerase. The gene product is responsible for mitochondrial gene expression as well as for providing RNA primers for initiation of replication of the mitochondrial genome. Although this polypeptide has the same function as the three nuclear DNA-directed RNA polymerases, it is more closely related to RNA polymerases of phage and mitochondrial polymerases of lower eukaryotes. [provided by RefSeq

Sequence: PNFIHSLDSSHMMLTALHCYRKGLTFVSVHDCYWTHAADVSVMNQVCREQFVRLHSEPILQDLSRFLVKRFCSEPQKILEASQLKETLQAVPKPGAFDLEQVKRSTYFFS

Specifications

• Antigen: polymerase (RNA) mitochondrial (DNA directed)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant POLRMT.
• Gene: POLRMT
• Gene Alias: APOLMT/MTRNAP/MTRPOL/h-mtRPOL
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 5442
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_005035
• Gene Symbols: POLRMT
• Immunogen: POLRMT (NP_005026, 1121 a.a. ∼ 1230 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum