polymerase (RNA) mitochondrial (DNA directed), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-251	50 μL

Catalog No. 89-004-251 Supplier Abnova Corporation Supplier No. H00005442A01

Description

Mouse polyclonal antibody raised against a partial recombinant POLRMT.

This gene encodes a mitochondrial DNA-directed RNA polymerase. The gene product is responsible for mitochondrial gene expression as well as for providing RNA primers for initiation of replication of the mitochondrial genome. Although this polypeptide has the same function as the three nuclear DNA-directed RNA polymerases, it is more closely related to RNA polymerases of phage and mitochondrial polymerases of lower eukaryotes. [provided by RefSeq

Sequence: PNFIHSLDSSHMMLTALHCYRKGLTFVSVHDCYWTHAADVSVMNQVCREQFVRLHSEPILQDLSRFLVKRFCSEPQKILEASQLKETLQAVPKPGAFDLEQVKRSTYFFS

Specifications

• Antigen: polymerase (RNA) mitochondrial (DNA directed)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant POLRMT.
• Formulation: 50% glycerol
• Gene: POLRMT
• Gene Accession No.: NM_005035
• Gene Alias: APOLMT/MTRNAP/MTRPOL/h-mtRPOL
• Gene Symbols: POLRMT
• Host Species: Mouse
• Immunogen: POLRMT (NP_005026, 1121 a.a. ∼ 1230 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5442
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum