POU3F2, Mouse, Clone: 1H5, Abnova™

Catalog No.	Quantity
89-123-269	100 μg

Catalog No. 89-123-269 Supplier Abnova Corporation Supplier No. H00005454M03

Description

Mouse monoclonal antibody raised against a partial recombinant POU3F2.

POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, that occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176) and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression (Schreiber et al., 1993 [PubMed 8441633]; Atanasoski et al., 1995 [PubMed 7601453]).[supplied by OMIM

Sequence: MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSH

Specifications

• Antigen: POU3F2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1H5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant POU3F2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: POU3F2
• Gene Accession No.: NM_005604
• Gene Alias: BRN2/OCT7/OTF7/POUF3
• Gene Symbols: POU3F2
• Host Species: Mouse
• Immunogen: POU3F2 (NP_005595, 1 a.a. ∼ 67 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5454
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ