Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

POU4F3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant POU4F3.

Manufacturer:  Abnova Corporation H00005459A01

Catalog No. 89-003-057


Add to cart

Description

Description

This gene encodes a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. This protein is found in the retina and may play a role in determining or maintaining the identities of a small subset of visual system neurons. Defects in this gene are the cause of nonsyndromic sensorineural deafness autosomal dominant type 15. [provided by RefSeq

Sequence: PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF
Specifications

Specifications

POU4F3
Unconjugated
50% glycerol
NM_002700
BRN3C|DFNA15|MGC138412
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA
Mouse polyclonal antibody raised against a partial recombinant POU4F3.
POU4F3
Liquid
POU4F3
POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
RUO
Primary
5459
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit