mediator complex subunit 1, Mouse, Clone: 1G3, Abnova™

Catalog No.	Quantity
89-000-891	100 μg

Catalog No. 89-000-891 Supplier Abnova Corporation Supplier No. H00005469M02

Description

Mouse monoclonal antibody raised against a partial recombinant PPARBP.

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. It also regulates p53-dependent apoptosis and it is essential for adipogenesis. This protein is known to have the ability to self-oligomerize. [provided by RefSeq

Sequence: KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP

Specifications

• Antigen: mediator complex subunit 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1G3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PPARBP.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MED1
• Gene Accession No.: NM_004774
• Gene Alias: CRSP1/CRSP200/DRIP205/DRIP230/MGC71488/PBP/PPARBP/PPARGBP/RB18A/TRAP220/TRIP2
• Gene Symbols: MED1
• Host Species: Mouse
• Immunogen: PPARBP (NP_004765, 1391 a.a. ∼ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5469
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ