peroxisome proliferator-activated receptor gamma, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PPARG.

Supplier:  Abnova Corporation H00005468A01

Catalog No. 89-018-835

Description

This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq

Sequence: FEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

Specifications

• Antigen: peroxisome proliferator-activated receptor gamma
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PPARG.
• Gene: PPARG
• Gene Alias: CIMT1/NR1C3/PPARG1/PPARG2/PPARgamma
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Transcription Regulation
• Gene ID (Entrez): 5468
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_138712
• Gene Symbols: PPARG
• Immunogen: PPARG (NP_619726, 366 a.a. ∼ 475 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum