Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPARGC1A, Mouse, Clone: 2F10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.

Manufacturer:  Abnova Corporation H00010891M18

Catalog No. 89-002-784


Add to cart

Description

Description

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. [provided by RefSeq

Sequence: TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Specifications

Specifications

PPARGC1A,
2F10
Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.
PPARGC1A
Liquid
PPARGC1A
PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Western Blot
Unconjugated
In 1X PBS, pH 7.4
NM_013261
LEM6|PGC-1(alpha)|PGC-1v|PGC1|PGC1A|PPARGC1
Mouse
IgG2a Kappa
RUO
Primary
10891
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit