PPARGC1A, Mouse, Clone: 2F10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.

Supplier:  Abnova Corporation H00010891M18

Catalog No. 89-002-784

Description

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. [provided by RefSeq

Sequence: TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Specifications

• Antigen: PPARGC1A,
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1X PBS, pH 7.4
• Gene Accession No.: NM_013261
• Gene Symbols: PPARGC1A
• Immunogen: PPARGC1A (NP_037393, 689 a.a. ∼ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 10891
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 2F10
• Description: Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.
• Gene: PPARGC1A
• Gene Alias: LEM6/PGC-1(alpha)/PGC-1v/PGC1/PGC1A/PPARGC1
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid