Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPARGC1A, Mouse, Clone: 3B5, Abnova™

Catalog No. 89002779 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-779 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-779 Supplier Abnova Corporation Supplier No. H00010891M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. [provided by RefSeq

Sequence: TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Specifications

Antigen PPARGC1A,
Applications ELISA, Immunofluorescence
Classification Monoclonal
Clone 3B5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.
Formulation In 1X PBS, pH 7.4
Gene PPARGC1A
Gene Accession No. NM_013261
Gene Alias LEM6/PGC-1(alpha)/PGC-1v/PGC1/PGC1A/PPARGC1
Gene Symbols PPARGC1A
Host Species Mouse
Immunogen PPARGC1A (NP_037393, 689 a.a. ∼ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10891
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.