peptidylprolyl isomerase A (cyclophilin A), Mouse, Clone: 1F4-1B5, Abnova™

Catalog No.	Quantity
89-014-173	100 μg

Catalog No. 89-014-173 Supplier Abnova Corporation Supplier No. H00005478M01

Description

Mouse monoclonal antibody raised against a full-length recombinant PPIA.

This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq

Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Specifications

• Antigen: peptidylprolyl isomerase A (cyclophilin A)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1F4-1B5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant PPIA.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PPIA
• Gene Accession No.: BC000689
• Gene Alias: CYPA/CYPH/MGC117158/MGC12404/MGC23397
• Gene Symbols: PPIA
• Host Species: Mouse
• Immunogen: PPIA (AAH00689.1, 1 a.a. ∼ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Gene ID (Entrez): 5478
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ