peptidylprolyl isomerase A (cyclophilin A), Mouse, Clone: 1F4-1B5, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant PPIA.

Supplier:  Abnova Corporation H00005478M01

Catalog No. 89-014-173

Description

This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq

Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Specifications

• Antigen: peptidylprolyl isomerase A (cyclophilin A)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC000689
• Gene Symbols: PPIA
• Immunogen: PPIA (AAH00689.1, 1 a.a. ∼ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Stem Cell Biology
• Gene ID (Entrez): 5478
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 1F4-1B5
• Description: Mouse monoclonal antibody raised against a full length recombinant PPIA.
• Gene: PPIA
• Gene Alias: CYPA/CYPH/MGC117158/MGC12404/MGC23397
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody