Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

peptidylprolyl isomerase E (cyclophilin E) (A01), Mouse anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PPIE.

Manufacturer:  Abnova Corporation H00010450A01

Catalog No. 89-004-493


Add to cart

Description

Description

The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq

Sequence: ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDD
Specifications

Specifications

peptidylprolyl isomerase E (cyclophilin E)
Unconjugated
50% glycerol
NM_006112
CYP-33|MGC111222|MGC3736
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
10450
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PPIE.
PPIE
Serum
PPIE
PPIE (NP_006103, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Murine, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit