peptidylprolyl isomerase E (cyclophilin E) (A01), Mouse anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PPIE.

Supplier:  Abnova Corporation H00010450A01

Catalog No. 89-004-493

Description

The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq

Sequence: ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDD

Specifications

• Antigen: peptidylprolyl isomerase E (cyclophilin E)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PPIE.
• Gene: PPIE
• Gene Alias: CYP-33/MGC111222/MGC3736
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 10450
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006112
• Gene Symbols: PPIE
• Immunogen: PPIE (NP_006103, 2 a.a. ∼ 100 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Serum