protein phosphatase 1D magnesium-dependent, delta isoform, Mouse, Clone: 4D1, Abnova™

Catalog No.	Quantity
89-014-222	100 μg

Catalog No. 89-014-222 Supplier Abnova Corporation Supplier No. H00008493M01

Description

Mouse monoclonal antibody raised against a partial recombinant PPM1D.

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. The expression of this gene is induced in a p53-dependent manner in response to various environmental stresses. While being induced by tumor suppressor protein TP53/p53, this phosphatase negatively regulates the activity of p38 MAP kinase, MAPK/p38, through which it reduces the phosphorylation of p53, and in turn suppresses p53-mediated transcription and apoptosis. This phosphatase thus mediates a feedback regulation of p38-p53 signaling that contributes to growth inhibition and the suppression of stress induced apoptosis. This gene is located in a chromosomal region known to be amplified in breast cancer. The amplification of this gene has been detected in both breast cancer cell line and primary breast tumors, which suggests a role of this gene in cancer development. [provided by RefSeq

Sequence: IGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVC

Specifications

• Antigen: protein phosphatase 1D magnesium-dependent, delta isoform
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4D1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PPM1D.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PPM1D
• Gene Accession No.: NM_003620
• Gene Alias: PP2C-DELTA/WIP1
• Gene Symbols: PPM1D
• Host Species: Mouse
• Immunogen: PPM1D (NP_003611, 496 a.a. ∼ 605 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 8493
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ