protein phosphatase 1F (PP2C domain containing) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-448	50 μL

Catalog No. 89-004-448 Supplier Abnova Corporation Supplier No. H00009647A01

Description

Mouse polyclonal antibody raised against a partial recombinant PPM1F.

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq

Sequence: MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAAALAHEAVSQLLQTDLSEFRKLPR

Specifications

• Antigen: protein phosphatase 1F (PP2C domain containing)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PPM1F.
• Formulation: 50% glycerol
• Gene: PPM1F
• Gene Accession No.: NM_014634
• Gene Alias: CaMKPase/FEM-2/KIAA0015/POPX2/hFEM-2
• Gene Symbols: PPM1F
• Host Species: Mouse
• Immunogen: PPM1F (NP_055449, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9647
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum