protein phosphatase 1, catalytic subunit, alpha isoform, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-252	50 μL

Catalog No. 89-004-252 Supplier Abnova Corporation Supplier No. H00005499A01

Description

Mouse polyclonal antibody raised against a partial recombinant PPP1CA.

The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Specifications

• Antigen: protein phosphatase 1, catalytic subunit, alpha isoform
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PPP1CA.
• Formulation: 50% glycerol
• Gene: PPP1CA
• Gene Accession No.: NM_002708
• Gene Alias: MGC15877/MGC1674/PP-1A/PPP1A
• Gene Symbols: PPP1CA
• Host Species: Mouse
• Immunogen: PPP1CA (NP_002699, 224 a.a. ∼ 330 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5499
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum