protein phosphatase 1, regulatory (inhibitor) subunit 1B, Mouse, Clone: 3G11, Abnova™

Catalog No.	Quantity
89-001-370	100 μg

Catalog No. 89-001-370 Supplier Abnova Corporation Supplier No. H00084152M03

Description

Mouse monoclonal antibody raised against a full-length recombinant PPP1R1B.

Midbrain dopaminergic neurons play a critical role in multiple brain functions, and abnormal signaling through dopaminergic pathways has been implicated in several major neurologic and psychiatric disorders. One well-studied target for the actions of dopamine is DARPP32. In the densely dopamine- and glutamate-innervated rat caudate-putamen, DARPP32 is expressed in medium-sized spiny neurons (Ouimet and Greengard, 1990 [PubMed 2191086]) that also express dopamine D1 receptors (Walaas and Greengard, 1984 [PubMed 6319627]). The function of DARPP32 seems to be regulated by receptor stimulation. Both dopaminergic and glutamatergic (NMDA) receptor stimulation regulate the extent of DARPP32 phosphorylation, but in opposite directions (Halpain et al., 1990 [PubMed 2153935]). Dopamine D1 receptor stimulation enhances cAMP formation, resulting in the phosphorylation of DARPP32 (Walaas and Greengard, 1984 [PubMed 6319627]); phosphorylated DARPP32 is a potent protein phosphatase-1 (see MIM 176875) inhibitor (Hemmings et al., 1984 [PubMed 6087160]). NMDA receptor stimulation elevates intracellular calcium, which leads to activation of calcineurin and dephosphorylation of phospho-DARPP32, thereby reducing the phosphatase-1 inhibitory activity of DARPP32 (Halpain et al., 1990 [PubMed 2153935]).[supplied by OMIM

Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT

Specifications

• Antigen: protein phosphatase 1, regulatory (inhibitor) subunit 1B
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3G11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant PPP1R1B.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PPP1R1B
• Gene Accession No.: BC001519
• Gene Alias: DARPP-32/DARPP32/FLJ20940
• Gene Symbols: PPP1R1B
• Host Species: Mouse
• Immunogen: PPP1R1B (AAH01519, 1 a.a. ∼ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 84152
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ