Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

protein phosphatase 1, regulatory (inhibitor) subunit 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PPP1R2.

Manufacturer:  Abnova Corporation H00005504A01

Catalog No. 89-004-253


Add to cart

Description

Description

Sequence: MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL
Specifications

Specifications

protein phosphatase 1, regulatory (inhibitor) subunit 2
Unconjugated
50% glycerol
NM_006241
IPP2|MGC87148
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
5504
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PPP1R2.
PPP1R2
Serum
PPP1R2
PPP1R2 (NP_006232, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit