Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPP2R2B, Mouse, Clone: 1F3, Abnova™

Catalog No. 89123270 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-270 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-270 Supplier Abnova Corporation Supplier No. H00005521M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant PPP2R2B.

The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a beta isoform of the regulatory subunit B55 subfamily. Defects in this gene cause autosomal dominant spinocerebellar ataxia 12 (SCA12), a disease caused by degeneration of the cerebellum, sometimes involving the brainstem and spinal cord, and in resulting in poor coordination of speech and body movements. Multiple alternatively spliced variants, which encode different isoforms, have been identified for this gene. The 5' UTR of some of these variants includes a CAG trinucleotide repeat sequence (7-28 copies) that can be expanded to 66-78 copies in cases of SCA12. [provided by RefSeq]

Sequence: TEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPE

Specifications

Antigen PPP2R2B
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1F3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PPP2R2B.
Formulation PBS with no preservative; pH 7.4
Gene PPP2R2B
Gene Accession No. BC031790
Gene Alias B55-BETA/FLJ95686/MGC24888/PP2A-B55BETA/PP2A-PR55B/PP2AB-BETA/PP2APR55-BETA/PR2AB-BETA/PR2AB55-BETA/PR2APR55-BETA/PR52B/PR55-BETA/SCA12
Gene Symbols PPP2R2B
Host Species Mouse
Immunogen PPP2R2B (AAH31790.1, 22 a.a. ∼ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5521
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.