protein phosphatase 2A activator, regulatory subunit 4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-254	50 μL

Catalog No. 89-004-254 Supplier Abnova Corporation Supplier No. H00005524A01

Description

Mouse polyclonal antibody raised against a partial recombinant PPP2R4.

Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B″/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: QNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLV

Specifications

• Antigen: protein phosphatase 2A activator, regulatory subunit 4
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PPP2R4.
• Formulation: 50% glycerol
• Gene: PPP2R4
• Gene Accession No.: NM_021131
• Gene Alias: MGC2184/PP2A/PR53/PTPA
• Gene Symbols: PPP2R4
• Host Species: Mouse
• Immunogen: PPP2R4 (NP_066954, 21 a.a. ∼ 120 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5524
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum