Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89016311

PRDM1, Mouse, Clone: 4A6, Abnova™

Catalog No. 89016311 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-311 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-311 Supplier Abnova Corporation Supplier No. H00000639M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PRDM1.

This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. [provided by RefSeq

Sequence: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH

Specifications

Antigen PRDM1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4A6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PRDM1.
Formulation PBS with no preservative; pH 7.4
Gene PRDM1
Gene Accession No. NM_001198
Gene Alias BLIMP1/MGC118922/MGC118923/MGC118924/MGC118925/PRDI-BF1
Gene Symbols PRDM1
Host Species Mouse
Immunogen PRDM1 (NP_001189, 1 a.a. ∼ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 639
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.