peroxiredoxin 1, Mouse, Clone: 4B11-D10, Abnova™

Catalog No.	Quantity
89-000-854	100 μg

Catalog No. 89-000-854 Supplier Abnova Corporation Supplier No. H00005052M01

Description

Mouse monoclonal antibody raised against a full-length recombinant PRDX1.

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Sequence: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFHPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Specifications

• Antigen: peroxiredoxin 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4B11-D10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant PRDX1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PRDX1
• Gene Accession No.: BC007063
• Gene Alias: MSP23/NKEFA/PAG/PAGA/PAGB/PRX1/PRXI/TDPX2
• Gene Symbols: PRDX1
• Host Species: Mouse
• Immunogen: PRDX1 (AAH07063, 1 a.a. ∼ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Stem Cell Biology
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5052
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ