PRDX2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-091	50 μL

Catalog No. 89-003-091 Supplier Abnova Corporation Supplier No. H00007001A01

Description

Mouse polyclonal antibody raised against a full-length recombinant PRDX2.

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Specifications

• Antigen: PRDX2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant PRDX2.
• Formulation: 50% glycerol
• Gene: PRDX2
• Gene Accession No.: BC000452
• Gene Alias: MGC4104/NKEFB/PRP/PRX2/PRXII/TDPX1/TSA
• Gene Symbols: PRDX2
• Host Species: Mouse
• Immunogen: PRDX2 (AAH00452, 1 a.a. ∼ 198 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7001
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid