Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

peroxiredoxin 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human PRDX2 protein.

Manufacturer:  Abnova Corporation H00007001B02P

Catalog No. 89-006-341


Add to cart

Description

Description

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Specifications

Specifications

peroxiredoxin 2
Unconjugated
In 1X PBS, pH 7.4
NM_005809.4
MGC4104|NKEFB|PRP|PRX2|PRXII|TDPX1|TSA
Mouse
Protein A column
RUO
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human PRDX2 protein.
PRDX2
Affinity Purified
PRDX2
PRDX2 (NP_005800.3, 1 a.a. ~ 198 a.a) full-length human protein.
50 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
7001
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit