peroxiredoxin 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-006-341	50 μg

Catalog No. 89-006-341 Supplier Abnova Corporation Supplier No. H00007001B02P

Description

Mouse polyclonal antibody raised against a full-length human PRDX2 protein.

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Specifications

• Antigen: peroxiredoxin 2
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human PRDX2 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PRDX2
• Gene Accession No.: NM_005809.4
• Gene Alias: MGC4104/NKEFB/PRP/PRX2/PRXII/TDPX1/TSA
• Gene Symbols: PRDX2
• Host Species: Mouse
• Immunogen: PRDX2 (NP_005800.3, 1 a.a. ∼ 198 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7001
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG