PRDX5, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-007-344	50 μL

Catalog No. 89-007-344 Supplier Abnova Corporation Supplier No. H00025824B01

Description

Mouse polyclonal antibody raised against a full-length human PRDX5 protein.

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

Specifications

• Antigen: PRDX5
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human PRDX5 protein.
• Formulation: No additive
• Gene: PRDX5
• Gene Accession No.: NM_012094.3
• Gene Alias: ACR1/AOEB166/B166/MGC117264/MGC142283/MGC142285/PLP/PMP20/PRDX6/PRXV/SBBI10
• Gene Symbols: PRDX5
• Host Species: Mouse
• Immunogen: PRDX5 (NP_036226.1, 1 a.a. ∼ 214 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 25824
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum