protein kinase, AMP-activated, alpha 1 catalytic subunit, Mouse, Clone: 4D8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PRKAA1.

Supplier:  Abnova Corporation H00005562M03

Catalog No. 89-000-892

Description

The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Sequence: LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ

Specifications

• Antigen: protein kinase, AMP-activated, alpha 1 catalytic subunit
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006251
• Gene Symbols: PRKAA1
• Immunogen: PRKAA1 (AAH12622, 451 a.a. ∼ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 4D8
• Description: Mouse monoclonal antibody raised against a partial recombinant PRKAA1.
• Gene: PRKAA1
• Gene Alias: AMPK/AMPKa1/MGC33776/MGC57364
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5562
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ