protein kinase, AMP-activated, beta 1 noncatalytic subunit, Mouse, Clone: 3H12-1A10, Abnova™

Catalog No.	Quantity
89-000-893	100 μg

Catalog No. 89-000-893 Supplier Abnova Corporation Supplier No. H00005564M01

Description

Mouse monoclonal antibody raised against a full-length recombinant PRKAB1.

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and noncatalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq

Sequence: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

Specifications

• Antigen: protein kinase, AMP-activated, beta 1 non-catalytic subunit
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3H12-1A10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant PRKAB1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PRKAB1
• Gene Accession No.: BC001007
• Gene Alias: AMPK/HAMPKb/MGC17785
• Gene Symbols: PRKAB1
• Host Species: Mouse
• Immunogen: PRKAB1 (AAH01007, 1 a.a. ∼ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5564
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ