protein kinase C, delta, Mouse, Clone: 2E12, Abnova™

Catalog No.	Quantity
89-000-895	100 μg

Catalog No. 89-000-895 Supplier Abnova Corporation Supplier No. H00005580M06

Description

Mouse monoclonal antibody raised against a partial recombinant PRKCD.

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq

Sequence: DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED

Specifications

• Antigen: protein kinase C, delta
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2E12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PRKCD.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PRKCD
• Gene Accession No.: NM_006254
• Gene Alias: MAY1/MGC49908/PKCD/nPKC-delta
• Gene Symbols: PRKCD
• Host Species: Mouse
• Immunogen: PRKCD (NP_006245, 577 a.a. ∼ 676 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5580
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ