protein kinase C, eta (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PRKCH.

Supplier:  Abnova Corporation H00005583A02

Catalog No. 89-004-260

Description

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. It is a calcium-independent and phospholipids-dependent protein kinase. It is predominantly expressed in epithelial tissues and has been shown to reside specifically in the cell nucleus. This protein kinase can regulate keratinocyte differentiation by activating the MAP kinase MAPK13 (p38delta)-activated protein kinase cascade that targets CCAAT/enhancer-binding protein alpha (CEBPA). It is also found to mediate the transcription activation of the transglutaminase 1 (TGM1) gene. [provided by RefSeq

Sequence: MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVAN

Specifications

• Antigen: protein kinase C, eta
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PRKCH.
• Gene: PRKCH
• Gene Alias: MGC26269/MGC5363/PKC-L/PKCL/PRKCL/nPKC-eta
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006255
• Gene Symbols: PRKCH
• Immunogen: PRKCH (NP_006246, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5583
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.