Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

protein kinase C, eta (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PRKCH.

Manufacturer:  Abnova Corporation H00005583A02

Catalog No. 89-004-260


Add to cart

Description

Description

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. It is a calcium-independent and phospholipids-dependent protein kinase. It is predominantly expressed in epithelial tissues and has been shown to reside specifically in the cell nucleus. This protein kinase can regulate keratinocyte differentiation by activating the MAP kinase MAPK13 (p38delta)-activated protein kinase cascade that targets CCAAT/enhancer-binding protein alpha (CEBPA). It is also found to mediate the transcription activation of the transglutaminase 1 (TGM1) gene. [provided by RefSeq

Sequence: MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVAN
Specifications

Specifications

protein kinase C, eta
Unconjugated
50% glycerol
NM_006255
MGC26269|MGC5363|PKC-L|PKCL|PRKCL|nPKC-eta
Mouse
50 uL
Kinases
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PRKCH.
PRKCH
Serum
PRKCH
PRKCH (NP_006246, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
5583
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit