protein kinase C, iota, Mouse, Clone: 3A7, Abnova™

Catalog No.	Quantity
89-000-896	100 μg

Catalog No. 89-000-896 Supplier Abnova Corporation Supplier No. H00005584M02

Description

Mouse monoclonal antibody raised against a partial recombinant PRKCI.

This gene encodes a member of the protein kinase C (PKC) family of serine/threonine protein kinases. The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. There is a single exon pseudogene mapped on chromosome X. [provided by RefSeq

Sequence: MSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCV

Specifications

• Antigen: protein kinase C, iota
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3A7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PRKCI.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PRKCI
• Gene Accession No.: BC022016
• Gene Alias: DXS1179E/MGC26534/PKCI/nPKC-iota
• Gene Symbols: PRKCI
• Host Species: Mouse
• Immunogen: PRKCI (AAH22016, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5584
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ