protein kinase D3, Mouse, Clone: 4G7, Abnova™

Catalog No.	Quantity
89-014-291	100 μg

Catalog No. 89-014-291 Supplier Abnova Corporation Supplier No. H00023683M01

Description

Mouse monoclonal antibody raised against a partial recombinant PRKD3.

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role. The protein encoded by this gene is one of the PKC family members. This kinase can be activated rapidly by the agonists of G protein-coupled receptors. It resides in both cytoplasm and nucleus, and its nuclear accumulation is found to be dramatically enhanced in response to its activation. This kinase can also be activated after B-cell antigen receptor (BCR) engagement, which requires intact phopholipase C gamma and the involvement of other PKC family members. [provided by RefSeq

Sequence: MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPEC

Specifications

• Antigen: protein kinase D3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4G7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PRKD3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PRKD3
• Gene Accession No.: BC030706
• Gene Alias: EPK2/PKC-NU/PKD3/PRKCN/nPKC-NU
• Gene Symbols: PRKD3
• Host Species: Mouse
• Immunogen: PRKD3 (AAH30706, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Gene ID (Entrez): 23683
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ