protein kinase, DNA-activated, catalytic polypeptide, Mouse, Clone: 2A8, Abnova™

Catalog No.	Quantity
89-000-897	100 μg

Catalog No. 89-000-897 Supplier Abnova Corporation Supplier No. H00005591M03

Description

Mouse monoclonal antibody raised against a partial recombinant PRKDC.

The PRKDC gene encodes the catalytic subunit of a nuclear DNA-dependent serine/threonine protein kinase (DNA-PK). The second component is the autoimmune antigen Ku (MIM 152690), which is encoded by the G22P1 gene on chromosome 22q. On its own, the catalytic subunit of DNA-PK is inactive and relies on the G22P1 component to direct it to the DNA and trigger its kinase activity; PRKDC must be bound to DNA to express its catalytic properties.[supplied by OMIM

Sequence: KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGREPWM

Specifications

• Antigen: protein kinase, DNA-activated, catalytic polypeptide
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 2A8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PRKDC.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PRKDC
• Gene Accession No.: NM_006904
• Gene Alias: DNA-PKcs/DNAPK/DNPK1/HYRC/HYRC1/XRCC7/p350
• Gene Symbols: PRKDC
• Host Species: Mouse
• Immunogen: PRKDC (NP_008835, 4019 a.a. ∼ 4128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5591
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ