Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

protein kinase, interferon-inducible double stranded RNA dependent activator, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PRKRA.

Manufacturer:  Abnova Corporation H00008575A02

Catalog No. 89-004-398


Add to cart

Description

Description

This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: ANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENH
Specifications

Specifications

protein kinase, interferon-inducible double stranded RNA dependent activator
Unconjugated
50% glycerol
NM_003690
DYT16|HSD14|PACT|RAX
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8575
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PRKRA.
PRKRA
Serum
PRKRA
PRKRA (NP_003681, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit