PRKR interacting protein 1 (IL11 inducible), Mouse, Clone: 4D11-3F11, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant PRKRIP1.

Supplier:  Abnova Corporation H00079706M05

Catalog No. 89-001-351

Description

Sequence: MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR

Specifications

• Antigen: PRKR interacting protein 1 (IL11 inducible)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC014298
• Gene Symbols: PRKRIP1
• Immunogen: PRKRIP1 (AAH14298, 1 a.a. ∼ 184 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 79706
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 4D11-3F11
• Description: Mouse monoclonal antibody raised against a full length recombinant PRKRIP1.
• Gene: PRKRIP1
• Gene Alias: C114/FLJ13902/FLJ40957
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody