prokineticin 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-863	50 μL

Catalog No. 89-018-863 Supplier Abnova Corporation Supplier No. H00060675A01

Description

Mouse polyclonal antibody raised against a partial recombinant PROK2.

This gene encodes a protein expressed in the suprachiasmatic nucleus (SCN) circadian clock that may function as the output component of the circadian clock. The secreted form of the encoded protein may also serve as a chemoattractant for neuronal precursor cells in the olfactory bulb. Proteins from other vertebrates which are similar to this gene product were isolated based on homology to snake venom and secretions from frog skin, and have been shown to have diverse functions. Mutations in this gene are associated with Kallmann syndrome 4. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: LTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK

Specifications

• Antigen: prokineticin 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PROK2.
• Formulation: 50% glycerol
• Gene: PROK2
• Gene Accession No.: NM_021935
• Gene Alias: BV8/KAL4/MIT1/PK2
• Gene Symbols: PROK2
• Host Species: Mouse
• Immunogen: PROK2 (NP_068754, 20 a.a. ∼ 108 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Angiogenesis
• Primary or Secondary: Primary
• Gene ID (Entrez): 60675
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum