protein S (alpha), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-264	50 μL

Catalog No. 89-004-264 Supplier Abnova Corporation Supplier No. H00005627A01

Description

Mouse polyclonal antibody raised against a partial recombinant PROS1.

This gene encodes a vitamin K-dependent plasma protein that functions as a cofactor for the anticoagulant protease, activated protein C (APC) to inhibit blood coagulation. It is found in plasma in both a free, functionally active form and also in an inactive form complexed with C4b-binding protein. Mutations in this gene result in autosomal dominant hereditary thrombophilia. An inactive pseudogene of this locus is located at an adjacent region on chromosome 3. [provided by RefSeq

Sequence: GLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRP

Specifications

• Antigen: protein S (alpha)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PROS1.
• Formulation: 50% glycerol
• Gene: PROS1
• Gene Accession No.: NM_000313
• Gene Alias: PROS/PS21/PS22/PS23/PS24/PS25/PSA
• Gene Symbols: PROS1
• Host Species: Mouse
• Immunogen: PROS1 (NP_000304, 419 a.a. ∼ 516 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Cell Adhesion
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5627
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum