protease, serine, 21 (testisin), Mouse, Clone: 2E10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PRSS21.

Supplier:  Abnova Corporation H00010942M01

Catalog No. 89-001-197

Description

This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Alternative splicing of this gene results in three transcript variants encoding three different isoforms. [provided by RefSeq

Sequence: VSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGD

Specifications

• Antigen: protease, serine, 21 (testisin)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006799
• Gene Symbols: PRSS21
• Immunogen: PRSS21 (NP_006790, 121 a.a. ∼ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 10942
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA, Immunoprecipitation
• Clone: 2E10
• Description: Mouse monoclonal antibody raised against a partial recombinant PRSS21.
• Gene: PRSS21
• Gene Alias: ESP-1/ESP1/TEST1/TESTISIN
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody