protease, serine, 8, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-266	50 μL

Catalog No. 89-004-266 Supplier Abnova Corporation Supplier No. H00005652A01

Description

Mouse polyclonal antibody raised against a partial recombinant PRSS8.

This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine. [provided by RefSeq

Sequence: AEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGS

Specifications

• Antigen: protease, serine, 8
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PRSS8.
• Formulation: 50% glycerol
• Gene: PRSS8
• Gene Accession No.: NM_002773
• Gene Alias: CAP1/PROSTASIN
• Gene Symbols: PRSS8
• Host Species: Mouse
• Immunogen: PRSS8 (NP_002764, 33 a.a. ∼ 131 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5652
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum