Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

prostate stem cell antigen, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human PSCA protein.

Manufacturer:  Abnova Corporation H00008000B01P

Catalog No. 89-006-528


Add to cart

Description

Description

This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene has a nonsynonymous nucleotide polymorphism at its start codon. [provided by RefSeq

Sequence: MKAVLLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Specifications

Specifications

prostate stem cell antigen
Unconjugated
In 1X PBS, pH 7.4
NM_005672.3
PRO232
Mouse
Protein A column
RUO
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human PSCA protein.
PSCA
Affinity Purified
PSCA
PSCA (NP_005663.1, 1 a.a. ~ 123 a.a) full-length human protein.
50 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8000
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit