cytohesin 3, Mouse, Clone: 6D3-1A9, Abnova™

Catalog No.	Quantity
89-014-237	100 μg

Catalog No. 89-014-237 Supplier Abnova Corporation Supplier No. H00009265M01

Description

Mouse monoclonal antibody raised against a full-length recombinant PSCD3.

This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. [provided by RefSeq

Sequence: MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK*

Specifications

• Antigen: cytohesin 3
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 6D3-1A9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant PSCD3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CYTH3
• Gene Accession No.: BC008191
• Gene Alias: ARNO3/GRP1/PSCD3
• Gene Symbols: CYTH3
• Host Species: Mouse
• Immunogen: PSCD3 (AAH08191, 1 a.a. ∼ 180 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9265
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ